You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578044 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CYP1A1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58kDa |
Target | CYP1A1 |
UniProt ID | P04798 |
Protein Sequence | Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV |
NCBI | NP_000490 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P45 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: CYP1A1, Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: CYP1A1, Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Lanes: Lane 1: Human lung microsome lysate, Lane 2-5: 150 ug mouse lung microsome lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:10000, Gene Name: CYP1A1.
WB Suggested Anti-CYP1A1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human heart.
FC, ICC, IF, IHC, IHC-Fr, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating