You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584585 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CYP11B1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Porcine, Sheep |
Reactivity | Human, Monkey |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CYP11B1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58 kDa |
Target | CYP11B1 |
UniProt ID | P15538 |
Protein Sequence | Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL |
NCBI | NP_000488 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | FHI, CPN1, CYP11B, P450C11 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample type: 1. HEK293TN-GFP-hcyp11B1 (75 ug), 2. HEK293TN-GFP-hcyp11B2 (75 ug), Primary dilution: 1:100, Secondary Antibody: mouse anti-Rabbit HRP, Secondary dilution: 1:10000, Film Exposed for: 5 minutes.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: CYP11B1, Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: Monkey adrenal gland, Primary Antibody dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus, Gene Name: CYP11B1.
Sample Type: Monkey vagina, Primary Antibody dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus, Gene Name: CYP11B1.
WB Suggested Anti-CYP11B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver.
ICC, IF, IHC-P, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating