You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb371724 |
---|---|
Category | Antibodies |
Description | Cyclin T1/CCNT1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, IHC-Fr, WB |
Predicted Reactivity | Bovine |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM), different from the related mouse sequence by one amino acid. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 80685 MW |
UniProt ID | O60563 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Cyclin-T1;CycT1;Cyclin-T;CCNT1; Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U20S cells using anti-Cyclin T1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of U937 cells using anti-Cyclin T1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of Cyclin T1 using anti-Cyclin T1 antibody.Lane 1:rat kidney tissue; 2:mouse spleen tissue;3:JURKAT cell.
IF analysis of Cyclin T1 using anti-Cyclin T1 antibody.Cyclin T1 was detected in immunocytochemical section of A431 cells.
IHC analysis of Cyclin T1 using anti-Cyclin T1 antibody. Cyclin T1 was detected in a paraffin-embedded section of mouse intestine tissue.
IHC analysis of Cyclin T1 using anti-Cyclin T1 antibody. Cyclin T1 was detected in a paraffin-embedded section of rat intestine tissue.
IHC analysis of Cyclin T1 using anti-Cyclin T1 antibody. Cyclin T1 was detected in a paraffin-embedded section of human intestinal cancer tissue.
Filter by Rating