CY24B antibody

• Catalog Number: orb55682
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CY24B.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CY24B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 62 kDa
• Target: CYBB
• UniProt ID: P04839
• Protein Sequence: Synthetic peptide located within the following region: YGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRG
• NCBI: NP_000388
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CGD, NOX2, IMD34, AMCBX2, GP91-1, GP91PHOX, p91-PH
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/ml of the antibody was used in this experiment.

Host: Rabbit, Target Name: CY24B, Sample Tissue: HepG2 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: CYBB, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: CYBB, Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: CYBB, Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.

IHC Information: Lung, Human: Formalin-Fixed, Paraffin-Embedded (FFPE).

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.