CXCR4 monoclonal antibody (M02), clone 1F8

• Catalog Number: orb2291941
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CXCR4.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F8
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
• NCBI: AAH20968
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CXCR4 monoclonal antibody (M02), clone 1F8. Western Blot analysis of CXCR4 expression in human Intestinal wall.

Western Blot detection against Immunogen (30.8 KDa).