CXCR4 antibody

• Catalog Number: orb573686
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CXCR4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IHC, WB
• Predicted Reactivity: Equine, Porcine, Rabbit
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CXCR4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40 kDa
• Target: CXCR4
• UniProt ID: P61073
• Protein Sequence: Synthetic peptide located within the following region: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFL
• NCBI: NP_003458
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FB22, HM89, LAP3, LCR1, NPYR, WHIM, CD184, LAP-3,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: human colon tissues infected ex-vivo with HIV-1, Green: Primary, Blue: DAPI, Primary dilution: 1:100, Secondary Antibody: Donkey anti-Rabbit AF 488, Secondary dilution: 1:500.

CXCR4 antibody - N-terminal region (orb573686) validated by WB using 721_B cell Lysate at 0.2-1 ug/ml.

CXCR4 antibody - N-terminal region (orb573686) validated by WB using human microvascular endothelial cells (25 ug) at 1:1000.

Host: Rabbit, Target Name: CXCR4, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Immunohistochemistry with HMEC-1 and A549 cells tissue.

Sample Type: HMEC-1 and A549 cells. Cell Lines: 3201 are feline B lymphocyte cell line positive for CXCR4. The PBMCs used here are feline and should be negative or very low for CXCR4. HSB2 are a human T cell lymphoblastoid cell line positive for CXCR4. Jurkat are an immortalized human T lymphocytes that are positive for CXCR4.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-CXCR4 Antibody, Positive Control: Lane 1: 20 ug mouse brain extract, Lane 2: 20 ug mouse brain extract, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti rabbit-HRP, Secondry Antibody Dilution: 1:5000.

WB Suggested Anti-CXCR4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.