CXCL9 Protein, Mouse, Recombinant (Active)

Catalog Number: orb2815959

Catalog Number	orb2815959
Category	Proteins
Description	CXCL9 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P18340.
Tag	Tag Free
MW	12.2 kDa (Predicted)
UniProt ID	P18340
Protein Sequence	TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
Expression System	E. coli
Biological Origin	Mouse
Expression Region	22-126
Storage	-20°C
Note	For research use only
Application notes	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Expiration Date	6 months from date of receipt.

Item 1 of 1
Mouse CXCL9 protein (Active) [orb359096]
Purity:
> 95% as determined by SDS-PAGE and HPLC.
MW:
12.2 kDa
Source:
E.Coli
Sizes Available: 5 μg, 100 μg, 500 μg
Recombinant Mouse C-X-C motif chemokine 9 protein(Cxcl9) (Active) [orb1650751]
Sizes Available: 500 μg, 5 μg, 20 μg, 100 μg, 250 μg, 1 mg
RecombinantI‑TAC/CXCL11,Human(HEK293-expressed) [orb1494634]
Purity:
> 98% as analyzed by SDS-PAGE.
MW:
8.3 kDa, observed by reducing SDS-PAGE.
Source:
HEK 293
Sizes Available: 50 μg, 10 μg

Purity:	> 95% as determined by SDS-PAGE and HPLC.
MW:	12.2 kDa
Source:	E.Coli

Purity:	> 98% as analyzed by SDS-PAGE.
MW:	8.3 kDa, observed by reducing SDS-PAGE.
Source:	HEK 293