CTNNB1 antibody

• Catalog Number: orb592819
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CTNNB1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Rabbit, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CTNNB1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 86 kDa
• Target: CTNNB1
• Protein Sequence: Synthetic peptide located within the following region: DPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
• NCBI: XP_001133664
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EVR7, CTNNB, MRD19, NEDSDV, armadillo
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: CTNNB1, Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: CTNNB1, Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

CTNNB1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb592819 with 1:200 dilution. Western blot was performed using orb592819 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: CTNNB1 IP with orb592819 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Host: Mouse, Target Name: CTNNB1, Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Host: Mouse, Target Name: CTNNB1, Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: CTNNB1, Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Human Intestine

Rabbit Anti-CTNNB1 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-CTNNB1 Antibody, Catalog Number: orb592819, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Cytoplasm, Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Type: HCT116 cell lysate. CTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116.

WB Suggested Anti-CTNNB1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.