You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579650 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CTH |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CTH |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 45 kDa |
Target | CTH |
UniProt ID | P32929 |
Protein Sequence | Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF |
NCBI | NP_001893 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MGC9471 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 45 kDa, 41 kDa and 39 kDa.
Host: Rabbit, Target Name: CTH, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: CTH, Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: CTH, Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: CTH, Sample Type: Human K562 cell lysate, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target: CTH, Positive control (+): Human liver (LI), Negative control (-): 293T (2T), Antibody concentration: 3 ug/ml.
WB Suggested Anti-CTH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.
FC, WB | |
Bovine, Canine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating