CTF1 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2293964
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CTF1 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: CTF1 (NP_001321.1, 1 a.a. ~ 201 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
• NCBI: NP_001321.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CTF1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CTF1 expression in Jurkat.

Western Blot analysis of CTF1 expression in transfected 293T cell line by CTF1 MaxPab polyclonal antibody. Lane 1: CTF1 transfected lysate (21.20 KDa). Lane 2: Non-transfected lysate.