You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581169 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CTBP2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CTBP2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 106kDa |
Target | CTBP2 |
UniProt ID | P56545 |
Protein Sequence | Synthetic peptide located within the following region: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVA |
NCBI | NP_073713 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: complete mouse retina sections, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.
Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.
Host: Rabbit, Target Name: CTBP2, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 0.5 ug/ml.
Host: Rabbit, Target Name: CTBP2, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 0.5 ug/ml.
Host: Rabbit, Target Name: CTBP2, Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 0.5 ug/ml.
Host: Rabbit, Target Name: CTBP2, Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 0.5 ug/ml.
Host: Rabbit, Target Name: CTBP2, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: CTBP2, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-CTBP2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate. CTBP2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
FC, ICC, IF, IHC, WB | |
Bovine, Canine, Hamster, Monkey, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating