CTBP1 antibody

• Catalog Number: orb574219
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CTBP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Porcine, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CTBP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48kDa
• Target: CTBP1
• UniProt ID: Q13363
• Protein Sequence: Synthetic peptide located within the following region: TGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL
• NCBI: NP_001319
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BARS, HADDTS
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CTBP1 antibody - C-terminal region (orb574219), Catalog Number: orb574219, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasm and nucleus in Human Pineal Tissue, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Host: Mouse, Target Name: CTBP1, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Human Pancreas

WB Suggested Anti-CTBP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, CTBP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.