CSRP3 antibody

• Catalog Number: orb329761
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CSRP3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CSRP3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 21kDa
• Target: CSRP3
• UniProt ID: P50461
• Protein Sequence: Synthetic peptide located within the following region: QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCG
• NCBI: NP_003467
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CLP antibody, anti MLP antibody, anti CRP3 an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: CSRP3, Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: CSRP3, Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 0.5 ug/mL.

WB Suggested Anti-CSRP3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human heart.