CSNK2A2 Antibody

• Catalog Number: orb1098102
• Category: Antibodies
• Description: CSNK2A2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human CSNK2A2 (EHPYFYPVVKEQSQPCADNAVLSSGLTAAR).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 39 kDa
• UniProt ID: P19784
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Expiration Date: 12 months from date of receipt.

IHC analysis of CSNK2K2 using anti-CSNK2K2 antibody. CSNK2K2 was detected in a paraffin-embedded section of human bladder epithelial carcinoma tissue.

IHC analysis of CSNK2K2 using anti-CSNK2K2 antibody. CSNK2K2 was detected in a paraffin-embedded section of human endometrial cancer tissue.

IHC analysis of CSNK2K2 using anti-CSNK2K2 antibody. CSNK2K2 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue.

IHC analysis of CSNK2K2 using anti-CSNK2K2 antibody. CSNK2K2 was detected in a paraffin-embedded section of human colonic adenocarcinoma tissue.

IHC analysis of CSNK2K2 using anti-CSNK2K2 antibody. CSNK2K2 was detected in a paraffin-embedded section of human placenta tissue.

IHC analysis of CSNK2K2 using anti-CSNK2K2 antibody. CSNK2K2 was detected in a paraffin-embedded section of human liver cancer tissue.

IHC analysis of CSNK2K2 using anti-CSNK2K2 antibody. CSNK2K2 was detected in a paraffin-embedded section of mouse colon tissue.

IHC analysis of CSNK2K2 using anti-CSNK2K2 antibody. CSNK2K2 was detected in a paraffin-embedded section of mouse testis tissue.

IHC analysis of CSNK2K2 using anti-CSNK2K2 antibody. CSNK2K2 was detected in a paraffin-embedded section of rat colon tissue.

IHC analysis of CSNK2K2 using anti-CSNK2K2 antibody. CSNK2K2 was detected in a paraffin-embedded section of rat testis tissue.

IF analysis of CSNK2A2 using anti-CSNK2A2 antibody. CSNK2A2 was detected in an immunocytochemical section of Caco-2 cells.

Western blot analysis of CSNK2A2 using anti-CSNK2A2 antibody.

Flow Cytometry analysis of Caco-2 cells using anti-CSNK2A2 antibody(Blue line).Isotype control antibody(Green line) was rabbit IgG.Unlabelled sample(Red line) was also used as a control.

Flow Cytometry analysis of THP-1 cells using anti-CSNK2A2 antibody(Blue line).Isotype control antibody(Green line) was rabbit IgG.Unlabelled sample(Red line) was also used as a control.