You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330652 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CSNK1D |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CSNK1D |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 47kDa |
Target | CSNK1D |
UniProt ID | P48730 |
Protein Sequence | Synthetic peptide located within the following region: NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR |
NCBI | NP_001884 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HCKID antibody, anti CKIdelta antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Fetal Lung tissue using CSNK1D antibody
Western blot analysis of OVCAR-3 cell lysate tissue using CSNK1D antibody
Host: Rabbit, Target Name: CHAD, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: CSNK1D, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-CSNK1D Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: OVCAR-3 cell lysate.
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Porcine, Primate, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating