CSF3 MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2294046
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CSF3 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IP, WB
• Reactivity: Human
• Immunogen: CSF3 (NP_000750.1, 1 a.a. ~ 207 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
• NCBI: NP_000750.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of purified MaxPab antibody to CSF3 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoprecipitation of CSF3 transfected lysate using anti-CSF3 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CSF3 purified MaxPab mouse polyclonal antibody (B01P) (orb2294047).

Western Blot analysis of CSF3 expression in transfected 293T cell line by CSF3 MaxPab polyclonal antibody. Lane 1: CSF3 transfected lysate (22.3 KDa). Lane 2: Non-transfected lysate.