CSF1R monoclonal antibody (M01), clone 1G4

• Catalog Number: orb2294066
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CSF1R.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1G4
• Tested applications: ELISA, PLA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CSF1R (AAH47521, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
• NCBI: AAH47521
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CSF1R monoclonal antibody (M01), clone 1G4. Western Blot analysis of CSF1R expression in human colon.

Detection limit for recombinant GST tagged CSF1R is approximately 0.03 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between GRAP2 and CSF1R. HeLa cells were stained with anti-GRAP2 rabbit purified polyclonal 1:1200 and anti-CSF1R mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.63 KDa).