CSF1 antibody

• Catalog Number: orb325139
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CSF1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Guinea pig, Human, Rabbit, Rat
• Reactivity: Canine, Guinea pig, Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CSF1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45kDa
• Target: CSF1
• UniProt ID: Q5VVF3
• Protein Sequence: Synthetic peptide located within the following region: PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
• NCBI: NP_757349
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MCSF antibody, anti MGC31930 antibody, anti C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human liver tissue using CSF1 antibody

Western blot analysis of human liver tissue using CSF1 antibody

Western blot analysis of Jurkat cell lysate tissue using CSF1 antibody

WB Suggested Anti-CSF1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.

WB Suggested Anti-CSF1 antibody Titration: 1 ug/mL, Sample Type: Human liver.

Rabbit Anti-CSF1 Antibody, Catalog Number: orb325139, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.