You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573970 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CSEN |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CSEN |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 29kDa |
Target | KCNIP3 |
UniProt ID | Q9Y2W7 |
Protein Sequence | Synthetic peptide located within the following region: STVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYA |
NCBI | NP_038462 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CSEN, DREAM, KCHIP3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: KCNIP3, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
Human kidney
WB Suggested Anti-CSEN Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
ICC, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating