You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592936 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CSDA |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Porcine, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CSDA |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40kDa |
Target | YBX3 |
UniProt ID | P16989 |
Protein Sequence | Synthetic peptide located within the following region: AHVAGNPGGDAAPAATGTAAAASLAAAAGSEDAEKKVLATKVLGTVKWFN |
NCBI | NP_003642 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CSDA, DBPA, CSDA1, ZONAB Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-CSDA Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate.
Filter by Rating