Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His)

• Catalog Number: orb1979731
• Category: Proteins
• Description: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.3 kDa and the accession number is P0A370.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 17.3 kDa (predicted)
• UniProt ID: P0A370
• Protein Sequence: HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
• Expression System: P. pastoris (Yeast)
• Biological Origin: Bacillus thuringiensis subsp. kurstaki
• Biological Activity: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.3 kDa and the accession number is P0A370.
• Expression Region: 1022-1155 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.