CRELD1 antibody

• Catalog Number: orb579362
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CRELD1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CRELD1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45kDa
• Target: CRELD1
• UniProt ID: Q96HD1
• Protein Sequence: Synthetic peptide located within the following region: TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE
• NCBI: NP_001070883
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AVSD2, CIRRIN
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

WB Suggested Anti-CRELD1 Antibody Titration: 5.0 ug/ml, Positive Control: HepG2 cell lysate.