CRBN antibody

• Catalog Number: orb583354
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CRBN
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRBN
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50 kDa
• Target: CRBN
• UniProt ID: Q96SW2
• Protein Sequence: Synthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL
• NCBI: NP_057386
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MRT2, MRT2A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Host: Rabbit, Target Name: CRBN, Sample Tissue: Human DLD1 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: CRBN, Sample Tissue: Human HCT15, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: CRBN, Sample Tissue: Human Liver Tumor, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: CRBN, Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: CRBN, Sample Type: RPMI-8226 Whole cell lysates, Antibody dilution: 0.5 ug/ml.

Host: Rabbit, Target: CRBN, Positive control (+): HepG2 (HG), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

WB Suggested Anti-CRBN Antibody Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.