CPT1B antibody

• Catalog Number: orb330486
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CPT1B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPT1B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 88 kDa
• Target: CPT1B
• UniProt ID: Q92523
• Protein Sequence: Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
• NCBI: NP_004368
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CPT1-M antibody, anti KIAA1670 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Capan1 tissue using CPT1B antibody

Western blot analysis of human Capan1 tissue using CPT1B antibody

Western blot analysis of HT1080 cell lysate tissue using CPT1B antibody

Host: Mouse, Target Name: CPT1B, Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: CPT1B, Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: CPT1B, Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.

Host: Rabbit, Target Name: CPT1B, Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: CPT1B, Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target: CPT1B, Positive control (+): Hela (HL), Negative control (-): Human liver (LI), Antibody concentration: 0.5 ug/mL.

Application: IHC, Species+tissue/cell type: Species+tissue/cell type: Human Capan1 cells, Primary antibody Dilution: 1:300, Secondary antibody: Anti-rabbit Alexa Fluor 488, Secondary antibody Dilution: 1:200.

Sample Type: 1: 45 ug human capan1 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: CPT1B.

WB Suggested Anti-CPT1B Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HT1080 cell lysate, CPT1B is supported by BioGPS gene expression data to be expressed in HT1080.