CPT1B Antibody

• Catalog Number: orb308786
• Category: Antibodies
• Description: CPT1B Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, IHC-Fr, WB
• Reactivity: Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 87801 MW
• UniProt ID: Q92523
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Carnitine O-palmitoyltransferase 1, muscle isoform
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Rat Skeletal Muscle Tissue Lysate(Lane 1), Rat Cardiac Muscle Tissue Lysate(Lane 2), Mouse Skeletal Muscle Tissue Lysate(Lane 3), Mouse Cardiac Muscle Tissue Lysate(Lane 4), HELA Whole Cell Lysate(Lane 5) using CPT1B antibody

Western blot analysis of Rat Skeletal Muscle Tissue Lysate(Lane 1), Rat Cardiac Muscle Tissue Lysate(Lane 2), Mouse Skeletal Muscle Tissue Lysate(Lane 3), Mouse Cardiac Muscle Tissue Lysate(Lane 4), HELA Whole Cell Lysate(Lane 5) using CPT1B antibody

Western blot analysis of Rat Skeletal Muscle Tissue Lysate(Lane 1), Rat Cardiac Muscle Tissue Lysate(Lane 2), Mouse Skeletal Muscle Tissue Lysate(Lane 3), Mouse Cardiac Muscle Tissue Lysate(Lane 4), HELA Whole Cell Lysate(Lane 5) using CPT1B antibody