You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579286 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CPT1A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CPT1A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 88 kDa |
Target | CPT1A |
UniProt ID | P50416 |
Protein Sequence | Synthetic peptide located within the following region: LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN |
NCBI | NP_001027017 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CPT1, CPT1-L, L-CPT1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.
Host: Rabbit, Target Name: CPT1A, Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: CPT1A, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml.
Host: Rabbit, Target Name: CPT1A, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml.
Host: Rabbit, Target Name: CPT1A, Sample Tissue: Human MDA-MB-435s Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: CPT1A, Sample Tissue: Human Stomach Tumor, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: CPT1A, Sample Type: 293T, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Lanes: 1. 45 ug capan1 cell lysate, 2. 45 ug HPAF cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: CPT1A.
Sample Type: Human Capan1 cells (Pancreatic cancer cell line), Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-AlexaFluor-488, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: CPT1A: Green DAPI: Blue, Gene Name: CPT1A.
WB Suggested Anti-CPT1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.
ICC, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating