You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579542 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CPS1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast |
Reactivity | Human, Porcine |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CPS1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 165kDa |
Target | CPS1 |
UniProt ID | P31327 |
Protein Sequence | Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI |
NCBI | NP_001866 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PHN, CPSASE1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human Intestine
Sample Type: Pig duodenum, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-biotin, streptavidin-HRP, Secondary Antibody dilution: 1:500, Color/Signal Descriptions: Brown: CPS, Gene Name: CPS1.
Sample Type: Pig ileum, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-biotin, streptavidin-HRP, Secondary Antibody dilution: 1:500, Color/Signal Descriptions: Brown: CPS, Gene Name: CPS1.
Sample Type: Pig kidney, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-biotin, streptavidin-HRP, Secondary Antibody dilution: 1:500, Color/Signal Descriptions: Brown: CPS, Gene Name: CPS1.
WB Suggested Anti-CPS1 Antibody Titration: 5.0 ug/ml, Positive Control: Fetal liver cell lysate.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Monkey, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating