COX6C monoclonal antibody (M03), clone S51

• Catalog Number: orb2294227
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant COX6C.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: S51
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: COX6C (AAH00187, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
• NCBI: AAH00187
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged COX6C is approximately 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to COX6C on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1 ug/ml].

Western Blot detection against Immunogen (33.99 KDa).