You have no items in your shopping cart.
Cart summary
Item 1 of 4
Item 1 of 4
COX5B purified MaxPab mouse polyclonal antibody (B01P)
Catalog Number: orb2294236
| Catalog Number | orb2294236 |
|---|---|
| Category | Antibodies |
| Description | Mouse polyclonal antibody raised against a full-length human COX5B protein. |
| Species/Host | Mouse |
| Clonality | Polyclonal |
| Tested applications | IF, WB |
| Reactivity | Human |
| Immunogen | COX5B (NP_001853.2, 1 a.a. ~ 129 a.a) full-length human protein. |
| Conjugation | Unconjugated |
| Protein Sequence | MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH |
| NCBI | NP_001853.2 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
COX5B MaxPab polyclonal antibody. Western Blot analysis of COX5B expression in HepG2.
COX5B MaxPab polyclonal antibody. Western Blot analysis of COX5B expression in human pancreas.
Immunofluorescence of purified MaxPab antibody to COX5B on HeLa cell. [antibody concentration 10 ug/ml].
Western Blot analysis of COX5B expression in transfected 293T cell line by COX5B MaxPab polyclonal antibody. Lane 1: COX5B transfected lysate(14.19 KDa). Lane 2: Non-transfected lysate.
