You have no items in your shopping cart.
Cart summary
Item 1 of 6
Item 1 of 6
COX4I2 monoclonal antibody (M01), clone 1F2
Catalog Number: orb2290737
| Catalog Number | orb2290737 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant COX4I2. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 1F2 |
| Tested applications | ELISA, IHC-P, IP, WB |
| Reactivity | Human, Rat |
| Isotype | IgG2a Kappa |
| Immunogen | COX4I2 (NP_115998, 21 a.a. ~ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | MHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKT |
| NCBI | NP_115998 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western Blot detection against Immunogen (34.98 KDa).
COX4I2 monoclonal antibody (M01), clone 1F2. Western Blot analysis of COX4I2 expression in PC-12.
Detection limit for recombinant GST tagged COX4I2 is 0.03 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to COX4I2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Immunoprecipitation of COX4I2 transfected lysate using anti-COX4I2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with COX4I2 MaxPab rabbit polyclonal antibody.
Western Blot analysis of COX4I2 expression in transfected 293T cell line by COX4I2 monoclonal antibody (M01), clone 1F2. Lane 1: COX4I2 transfected lysate (Predicted MW: 20 KDa). Lane 2: Non-transfected lysate.
