COX4I1 Rabbit Polyclonal Antibody

• Catalog Number: orb330257
• Category: Antibodies
• Description: Rabbit polyclonal antibody to COX4I1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COX4I1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 19kDa
• Target: COX4I1
• UniProt ID: P13073
• Protein Sequence: Synthetic peptide located within the following region: AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK
• NCBI: NP_001852
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti COX4 antibody, anti COXIV antibody, anti MGC7
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

COX4I1 antibody - N-terminal region (orb330257) validated by WB using 1. Human liver, 2. Rat liver, 3. Wild-type mouse liver, 4. AMPKa1+2-/- mouse liver, 5. Human muscle, 6. Rat muscle, 7. Mouse muscle at 1:1000.

COX4I1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb330257 with 1:200 dilution. Western blot was performed using orb330257 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: COX4I1 IP with orb330257 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Human Heart

Human kidney

Lanes: Lane 1: 50 ug HeLa lysate, Lane 2: 50 ug 293T lysate, Lane 3: 50 ug K562 lysate, Lane 4: 50 ug MDA-MB-231 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Gene Name: COX4I1.

Rabbit Anti-COX4I1 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-COX4I1 Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate, COX4I1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.