COX17 monoclonal antibody (M01), clone 4G2

• Catalog Number: orb2291627
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant COX17.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4G2
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: COX17 (NP_005685, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
• NCBI: NP_005685
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

COX17 monoclonal antibody (M01), clone 4G2. Western Blot analysis of COX17 expression in IMR-32.

Detection limit for recombinant GST tagged COX17 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to COX17 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (32.67 KDa).