You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579790 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to COX15 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human COX15 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 46 kDa |
Target | COX15 |
UniProt ID | Q7KZN9 |
Protein Sequence | Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY |
NCBI | NP_004367 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MC4DN6, CEMCOX2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Lanes: Lane 1: 20 ug human fibroblast mitochondria, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: COX15.
Rabbit Anti-COX15 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-COX15 Antibody Titration: 5.0 ug/ml, Positive Control: HepG2 cell lysate. COX15 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Filter by Rating