You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1978928 |
---|---|
Category | Proteins |
Description | CORIN Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.0 kDa and the accession number is Q9Y5Q5. |
Tag | N-6xHis |
Purity | 98.00% |
MW | 16.0 kDa (predicted) |
UniProt ID | Q9Y5Q5 |
Protein Sequence | MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS |
Expression System | E. coli |
Biological Origin | Human |
Biological Activity | CORIN Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.0 kDa and the accession number is Q9Y5Q5. |
Expression Region | 1-110 aa |
Storage | -20°C |
Note | For research use only |
Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Expiration Date | 6 months from date of receipt. |
48.1 kDa (Predicted) |