You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585618 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to COQ9 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | COQ9 |
UniProt ID | O75208 |
Protein Sequence | Synthetic peptide located within the following region: ASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGE |
NCBI | NP_064708 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | COQ10D5, C16orf49 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-COQ9 Antibody, Catalog Number: orb585618, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-COQ9 Antibody, Titration: 1.0 ug/ml, Positive Control: HCT15 Whole Cell. COQ9 is supported by BioGPS gene expression data to be expressed in HCT15.
Filter by Rating