You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331035 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to COPS3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human COPS3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 44kDa |
Target | COPS3 |
UniProt ID | Q9UNS2 |
Protein Sequence | Synthetic peptide located within the following region: HNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CSN3, SGN3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
COPS3 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb331035 with 1:200 dilution. Western blot was performed using orb331035 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: COPS3 IP with orb331035 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.
Host: Rabbit, Target Name: COPS3, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: COPS3, Sample Type: Fetal Brain lysates, Antibody dilution: 1.0 ug/ml.
IF, IH, WB | |
Human, Mouse, Porcine, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating