COPS3 antibody

• Catalog Number: orb331035
• Category: Antibodies
• Description: Rabbit polyclonal antibody to COPS3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human COPS3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 44kDa
• Target: COPS3
• UniProt ID: Q9UNS2
• Protein Sequence: Synthetic peptide located within the following region: HNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CSN3, SGN3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

COPS3 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb331035 with 1:200 dilution. Western blot was performed using orb331035 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: COPS3 IP with orb331035 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

Host: Rabbit, Target Name: COPS3, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: COPS3, Sample Type: Fetal Brain lysates, Antibody dilution: 1.0 ug/ml.