You have no items in your shopping cart.
Cart summary
Copeptin Active Peptide
Catalog Number: orb1974385
| Catalog Number | orb1974385 |
|---|---|
| Category | Proteins |
| Description | Copeptin Active Peptide |
| Form/Appearance | Lyophilized powder |
| Target | AVP |
| UniProt ID | P01185 |
| Protein Sequence | SDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY |
| Storage | Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles. |
| Alternative names | Vasopressin; Antidiuretic Hormone; Arginine Vasopr Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
