You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325700 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to COPA |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human COPA |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 138 kDa |
Target | COPA |
UniProt ID | P53621 |
Protein Sequence | Synthetic peptide located within the following region: PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD |
NCBI | NP_004362 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ26320 antibody, anti HEP-COP antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.
Host: Rabbit, Target Name: COPA, Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: COPA, Sample Type: Hela Whole Cell lysates, Antibody Dilution: 3.0 ug/mL.
Host: Rabbit, Target Name: COPA, Sample Type: Hela Whole Cell lysates, Antibody Dilution: 3 ug/mL.
Host: Rabbit, Target: COPA, Positive control (+): Hela (HL), Negative control (-): Human heart (HE), Antibody concentration: 1 ug/mL.
WB Suggested Anti-COPA Antibody Titration: 0.2-1 ug/mL, Positive Control: Hela cell lysate, COPA is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
ELISA, WB | |
Bovine, Human, Mouse, Porcine, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Bovine, Mouse, Porcine, Rat | |
Human | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating