Collagen I antibody

• Catalog Number: orb331081
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Collagen I
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human COL1A1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 139 kDa
• Target: COL1A1
• UniProt ID: P02452
• Protein Sequence: Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS
• NCBI: NP_000079
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Anti-CO1A1_HUMAN antibody, anti-Collagen I antibod
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Muscle tissue using COL1A1 antibody

Immunohistochemical staining of mouse blastocyte tissue using COL1A1 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~31 kDa.

Host: Rabbit, Target Name: COL1A1, Sample Tissue: Human 293T Whole Cell, Antibody dilution: 3 ug/ml.

Application: IHC, Species+tissue/cell type: Species+tissue/cell type: Mouse blastocyte, Primary antibody dilution: 1:200, Secondary antibody: Anti-rabbit-Alexa 488, Secondary antibody dilution: 1:200.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-COL1A1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.