Cart summary

You have no items in your shopping cart.

    COLEC10 Antibody - N-terminal region : FITC

    COLEC10 Antibody - N-terminal region : FITC

    Catalog Number: orb2089734

    DispatchUsually dispatched within 5-10 working days
    $ 632.00
    Catalog Numberorb2089734
    CategoryAntibodies
    DescriptionCOLEC10 Antibody - N-terminal region : FITC
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human COLEC10
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationFITC
    MW30kDa
    UniProt IDQ9Y6Z7
    Protein SequenceSynthetic peptide located within the following region: IKGELGDMGDQGNIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCDCGRY
    NCBINP_006429
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    Alternative names3MC3, CLL1, CL-34
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars