CNTF Protein

• Catalog Number: orb2023526
• Category: Proteins
• Description: CNTF Protein
• Species/Host: E. coli
• Form/Appearance: Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Purity: Greater than 99.0% as determined by (a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
• UniProt ID: P20294
• Protein Sequence: AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM.
• NCBI: NP_037298.1
• Storage: Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -1°C. Upon reconstitution CNTF should be stored at 4C between 2-7 days and for future use below -1°C. Please prevent freeze-thaw cycles.
• Buffer/Preservatives: Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Alternative names: HCNTF, CNTF, Ciliary Neurotrophic Factor, CNTF Rat
• Note: For research use only
• Expiration Date: 6 months from date of receipt.