You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2816345 |
---|---|
Category | Proteins |
Description | CNTF Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P26441. |
Tag | Tag Free |
MW | 22.9 kDa (Predicted) |
UniProt ID | P26441 |
Protein Sequence | MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
Expression System | E. coli |
Biological Origin | Human |
Expression Region | 1-200 aa |
Storage | -20°C |
Note | For research use only |
Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Expiration Date | 6 months from date of receipt. |
> 97% as determined by SDS-PAGE and HPLC. | |
22.9 kDa | |
E.Coli |
Greater than 95.0% as determined by SDS-PAGE. | |
Escherichia Coli |
> 95% as analyzed by SDS-PAGE. | |
24~26kDa, observed by reducing SDS-PAGE. | |
CHO |