CNTF MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2294282
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CNTF protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Reactivity: Human
• Immunogen: CNTF (NP_000605.1, 1 a.a. ~ 200 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
• NCBI: NP_000605.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of CNTF transfected lysate using anti-CNTF MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CNTF purified MaxPab mouse polyclonal antibody (B01P) (orb2294283).

Western Blot analysis of CNTF expression in transfected 293T cell line by CNTF MaxPab polyclonal antibody. Lane 1: CNTF transfected lysate(22.9 KDa). Lane 2: Non-transfected lysate.