CNP Rabbit Polyclonal Antibody

• Catalog Number: orb574864
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CNP
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CNP
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45kDa
• Target: CNP
• UniProt ID: P09543
• Protein Sequence: Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF
• NCBI: NP_149124
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CNP1, HLD20
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Amount and Sample Type: 500 ug mouse brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: CNP, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: CNP.

IP Suggested Anti-CNP Antibody, Positive Control: NT2 CELL/BRAIN TISSUE.

Lanes: 1. Human NT-2 cells (60 ug) lysate 2. Rat brain extract (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000, Gene Name: CN.

Rabbit Anti-CNP antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-CNP Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate, CNP is supported by BioGPS gene expression data to be expressed in Jurkat.