You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574863 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CNP |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CNP |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 47kDa |
Target | CNP |
UniProt ID | P09543 |
Protein Sequence | Synthetic peptide located within the following region: LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII |
NCBI | NP_149124 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CNP1, HLD20 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Brain, cortex.
Host: Rabbit, Target Name: CNP, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
human optic nerve and spinal cord
WB Suggested Anti-CNP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Fetal Muscle.
ELISA, FC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IP, WB | |
Bovine, Canine, Equine, Porcine, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating