You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576939 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CNOT7 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CNOT7 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 30kDa |
Target | CNOT7 |
UniProt ID | Q9UIV1 |
Protein Sequence | Synthetic peptide located within the following region: TEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPP |
NCBI | NP_037486 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CAF1, CAF-1, Caf1a, hCAF-1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-CNOT7 antibody, Paraffin Embedded Tissue: Human Heart, cell Cellular Data: cardiac cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
WB Suggested Anti-CNOT7 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. CNOT7 is supported by BioGPS gene expression data to be expressed in HepG2.
IF, IHC-P, WB | |
Bovine, Gallus, Mouse, Xenopus, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Mouse, Other, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, IP, WB | |
Human, Monkey, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating