CMPK2 antibody

• Catalog Number: orb582105
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CMPK2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CMPK2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 49kDa
• Target: CMPK2
• UniProt ID: Q5EBM0
• Protein Sequence: Synthetic peptide located within the following region: PSCIGQWRKIFDDEPTIIRRAFYSLGNYIVASEIAKESAKSPVIVDRYWH
• NCBI: NP_997198
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NDK, TYKi, TMPK2, UMP-CMPK2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 49 kDa, 45 kDa, and 40 kDa. The protein is processed into 39 kDa.

Host: Rabbit, Target Name: CMPK2, Sample Type: Fetal Liver lysates, Antibody dilution: 1.0 ug/ml.