CLU monoclonal antibody (M01), clone 1A11

• Catalog Number: orb2294359
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CLU.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1A11
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CLU (NP_001822, 402 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
• NCBI: NP_001822.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CLU monoclonal antibody (M01), clone 1A11. Western Blot analysis of CLU expression in human pancreas.

Detection limit for recombinant GST tagged CLU is approximately 0.1 ng/ml as a capture antibody.

Western Blot analysis of CLU expression in transfected 293T cell line by CLU monoclonal antibody (M01), clone 1A11. Lane 1: CLU transfected lysate (Predicted MW: 49.39 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).