Clec1b antibody

• Catalog Number: orb580002
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Clec1b
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast
• Reactivity: Human, Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 26 kDa
• Target: Clec1b
• UniProt ID: Q9JL99
• Protein Sequence: Synthetic peptide located within the following region: MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVAL
• NCBI: NP_064369
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Clec, Clec-, Clec2, Clec-2, 1810061I13Rik
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. This peptide sequence matches human CLEC1B 100% and mouse Clec1b 93% amino acid identity. The protein may be phosphorylated and/or glycosylated.

Rabbit Anti-Clec1b antibody, Formalin Fixed Paraffin Embedded Tissue: Human Fetal Liver, Primary antibody Concentration: 1:50, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-Clec1b Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Pancreas.