Clcn5 antibody

• Catalog Number: orb575317
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Clcn5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 83kDa
• Target: Clcn5
• UniProt ID: Q9WVD4
• Protein Sequence: Synthetic peptide located within the following region: LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL
• NCBI: NP_057900
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Clc, ClC-, Clc5, Sfc1, ClC-5, Clc4-, Clcn4, Sfc13,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: Clcn5, Sample Type: Mouse Brain, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: Clcn5, Sample Type: Mouse Heart, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: Clcn5, Sample Type: Mouse Kidney, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: Clcn5, Sample Type: Mouse Liver, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: Clcn5, Sample Type: Mouse Spleen, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: Clcn5, Sample Type: Rat Brain, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: Clcn5, Sample Type: Rat Liver, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: Clcn5, Sample Type: Rat Lung, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: Clcn5, Sample Type: Rat Muscle, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-Clcn5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Brain.